PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00048_0440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 446aa    MW: 48322.4 Da    PI: 7.3459
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00048_0440genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.51.9e-153273345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      W ++Ede+l+++vk++G++ W+++a++++ gR++ +ck+rw+
    kfl00048_0440 32 QWQEQEDEILKELVKRHGSKKWDLVAARLP-GRSAPDCKERWH 73
                     6*****************************.***********7 PP

2Myb_DNA-binding52.21.4e-1682126147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +WT+eEd++l++a k+ G++ W  Ia++++ gRt++ +k+r+q +
    kfl00048_0440  82 KSSWTEEEDKKLLEARKECGNK-WMEIAQRVP-GRTDNAVKNRYQAL 126
                      578*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4712576IPR017930Myb domain
SMARTSM007173.6E-112978IPR001005SANT/Myb domain
SuperFamilySSF466898.07E-2631123IPR009057Homeodomain-like
PfamPF002499.3E-143273IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-213285IPR009057Homeodomain-like
CDDcd001675.56E-133373No hitNo description
PROSITE profilePS5129421.20977131IPR017930Myb domain
SMARTSM007171.3E-1581129IPR001005SANT/Myb domain
PfamPF002492.2E-1582126IPR001005SANT/Myb domain
CDDcd001676.32E-1384127No hitNo description
Gene3DG3DSA:1.10.10.605.4E-1886129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MVKNKMGVLE LVHSSRQVPD KSSSEDEGLC SQWQEQEDEI LKELVKRHGS KKWDLVAARL  60
PGRSAPDCKE RWHAQLHASM NKSSWTEEED KKLLEARKEC GNKWMEIAQR VPGRTDNAVK  120
NRYQALKRRQ AEEASAAAGP VPTTTAAAPG FLMGPPEPQQ PRQKRKYTKR AVVNKEPLGV  180
IAEEDLPIGP STSGSGFSHA DKKPCIRPDL SIQIPSTSSA APVLPLAVGP PVIPEPLAYS  240
FPGRMTPNMM SSEAIQQLFC SSMTDTPRES IDMEEVMGWL TAQTPTPSTH YPGTASGTAN  300
SSLASSSFPS ASNTPARLTP SPGNMAGFKF TGPSPRQLMS SVHAAADDRR GFALGHSPAN  360
LMGPSLNVSE LEDLVRLLSG SEGAEPPAFG GYADLPRRGD GLDSFQTMGS THNFSFMGME  420
STRGPSFDHL SHGSLFTRPS FDDKIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-313313210109B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-31myb domain protein 98